Ver mas grande
iEscherichia coli/i dnaJ (NP_414556, 1 a.a. - 376 a.a.) full-length recombinant protein expressed in iEscherichia coli/i.
AB-P4967
Producto nuevo
dnaJ (Escherichia coli) Recombinant protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | dnaJ |
| Gene Alias | ECK0015|JW0014|groP|grpC |
| Gene Description | chaperone Hsp40, co-chaperone with DnaK |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MAKQDYYEILGVSKTAEEHEIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGGMGGGGFGGGADFSDIFGDVFGDIFGGGRGRQRAARGADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLAGEGEAGEHGAPAGDLYVQVQVKQHPI |
| Form | Liquid |
| Antigen species Target species | Escherichia coli |
| Quality control testing | 15% SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | In 25 mM Tris-HCl buffer, 100 mM NaCl, pH 8.8 (5 mM DTT, 10% glycerol). |
| Gene ID | 944753 |
Más información
Escherichia coli dnaJ (NP_414556, 1 a.a. - 376 a.a.) full-length recombinant protein expressed in Escherichia coli.