HBsAg (ayw) Recombinant Protein Ver mas grande

HBsAg (ayw) Recombinant Protein

AB-P4875

Producto nuevo

HBsAg (ayw) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 ug
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
Form Liquid
Antigen species Target species Viruses
Storage Buffer In 50 mM phosphate buffer, 200 mM NaCl, pH7.2

Más información

HBsAg (ayw) (CAA05872) full-length Recombinant protein expressed in yeast.

Consulta sobre un producto

HBsAg (ayw) Recombinant Protein

HBsAg (ayw) Recombinant Protein