Ver mas grande
IL25 (Rat) Recombinant Protein
AB-P4845
Producto nuevo
IL25 (Rat) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | IL25 |
| Gene Alias | IL-17E|IL-25|IL17E |
| Gene Description | interleukin 25 |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized 20 mM HCl, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MCSHLPRCCPSKQQEFPEEWLKWNPAPVSPPEPLRHTHHPESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPMGNSVPLYHNQTVFYRRPCHGEQGAHGRYCLERRLYRVSLACVCVRPRMMA |
| Form | Lyophilized |
| Antigen species Target species | Rat |
| Quality control testing | 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue |
| Storage Buffer | No additive |
| Gene ID | 64806 |
Más información
Rat IL25 recombinant protein expressed in Escherichia coli.