Il17a/Il17f (Mouse) Recombinant Protein Ver mas grande

Mouse Il17a/Il17f (heterodimer) recombinant protein expressed in iEscherichia coli/i.

AB-P4804

Producto nuevo

Il17a/Il17f (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 25 ug
Gene Name Il17a
Gene Alias Ctla-8|Ctla8|Il17
Gene Description interleukin 17A
Storage Conditions Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq Il17a: MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA<br>Il17f: MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRR
Form Lyophilized
Antigen species Target species Mouse
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue
Storage Buffer No additive
Gene ID 16171|257630

Más información

Mouse Il17a/Il17f (heterodimer) recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Mouse Il17a/Il17f (heterodimer) recombinant protein expressed in iEscherichia coli/i.

Mouse Il17a/Il17f (heterodimer) recombinant protein expressed in iEscherichia coli/i.