Ver mas grande
STK16 (Human) Recombinant Protein
AB-P4788
Producto nuevo
STK16 (Human) Recombinant Protein
Comprando este producto generará 22 Biopuntos. Su cesta contiene un total 22 Biopuntos puede ser convertido en un Biobonos Descuento 88.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | STK16 |
| Gene Alias | FLJ39635|KRCT|MPSK|PKL12|TSF1 |
| Gene Description | serine/threonine kinase 16 |
| Storage Conditions | Store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing |
| Concentration | 1.020 ug/uL |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDPMGHHHHHHGRRRASVAAGILVPRGSPGLDGIYAR |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 2 ug/lane SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | In 50 mM Tris-HCl, 100 mM NaCl, pH 8.0 (5 mM DTT, 15 mM reduced glutathione, 20% glycerol). |
| Gene ID | 8576 |
Más información
Human STK16 (NP_001008910.1, 1 a.a. - 305 a.a.) full-length recombinant protein with GST-His tag with a Thrombin cleavage site at N-terminal expressed in Sf9 insect cells.