Ver mas grande
Human IKBKB (NM_001556, 1 a.a. - 756 a.a.) full-length recombinant protein with GST-His tag expressed in Sf9 cells.
AB-P4703
Producto nuevo
IKBKB (Human) Recombinant Protein
Comprando este producto generará 22 Biopuntos. Su cesta contiene un total 22 Biopuntos puede ser convertido en un Biobonos Descuento 88.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | IKBKB |
| Gene Alias | FLJ40509|IKK-beta|IKK2|IKKB|MGC131801|NFKBIKB |
| Gene Description | inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta |
| Storage Conditions | Store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing |
| Concentration | 0.695 ug/uL |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKF |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 2 ug/lane SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | In 50 mM Hepes, 100 mM NaCl, pH 7.5. (5 mM DTT, 20% glycerol) |
| Gene ID | 3551 |
Más información
Human IKBKB (NM_001556, 1 a.a. - 756 a.a.) full-length recombinant protein with GST-His tag expressed in Sf9 cells.