Ver mas grande
Human GSK3B (NP_001139628.1, 1 a.a.- 420 a.a.) full-length recombinant protein with GST-His tag expressed in Sf9 cells.
AB-P4698
Producto nuevo
GSK3B (Human) Recombinant Protein
Comprando este producto generará 22 Biopuntos. Su cesta contiene un total 22 Biopuntos puede ser convertido en un Biobonos Descuento 88.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | GSK3B |
| Gene Alias | - |
| Gene Description | glycogen synthase kinase 3 beta |
| Storage Conditions | Store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing |
| Concentration | 0.276 ug/Ul |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQP |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 2 ug/lane SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | In 50 mM Hepes, 100 mM NaCl, pH 7.5. (5 mM DTT, 15 mM reduced glutathione, 20% glycerol) |
| Gene ID | 2932 |
Más información
Human GSK3B (NP_001139628.1, 1 a.a.- 420 a.a.) full-length recombinant protein with GST-His tag expressed in Sf9 cells.