Ver mas grande
Human ALK (NP_004295.2, 1066 a.a. - 1437 a.a.) partial recombinant protein with GST-His tag expressed in Sf9 cells.
AB-P4644
Producto nuevo
ALK (Human) Recombinant Protein
Comprando este producto generará 22 Biopuntos. Su cesta contiene un total 22 Biopuntos puede ser convertido en un Biobonos Descuento 88.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | ALK |
| Gene Alias | CD246|Ki-1|TFG/ALK |
| Gene Description | anaplastic lymphoma receptor tyrosine kinase |
| Storage Conditions | Store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | LQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLW |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 2 ug/lane SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | In 50 mM Hepes, 100 mM NaCl, pH 7.5. (5 mM DTT, 15 mM reduced glutathione, 20% glycerol) |
| Gene ID | 238 |
Más información
Human ALK (NP_004295.2, 1066 a.a. - 1437 a.a.) partial recombinant protein with GST-His tag expressed in Sf9 cells.