Ver mas grande
Mouse Vegfa (120 amino acids) recombinant protein expressed in iEscherichia coli/i.
AB-P4633
Producto nuevo
Vegfa (Mouse) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | Vegfa |
| Gene Alias | Vegf|Vegf-a|Vegf120|Vegf164|Vegf188|Vpf |
| Gene Description | vascular endothelial growth factor A |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | No additive |
| Gene ID | 22339 |
Más información
Mouse Vegfa (120 amino acids) recombinant protein expressed in Escherichia coli.