Il17f (Mouse) Recombinant Protein Ver mas grande

Il17f (Mouse) Recombinant Protein

AB-P4625

Producto nuevo

Il17f (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 25 ug
Gene Name Il17f
Gene Alias C87042|IL-17F
Gene Description interleukin 17F
Storage Conditions Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer No additive
Gene ID 257630

Más información

Mouse Il17f (Q7TN17) recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Il17f (Mouse) Recombinant Protein

Il17f (Mouse) Recombinant Protein