Ver mas grande
Shh (Mouse) Recombinant Protein
AB-P4621
Producto nuevo
Shh (Mouse) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | Shh |
| Gene Alias | 9530036O11Rik|Dsh|Hhg1|Hx|Hxl3|M100081 |
| Gene Description | sonic hedgehog |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MIIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized with 10 mM Na<sub>2</sub>PO<sub>4</sub>, pH 7.5. |
| Gene ID | 20423 |
Más información
Mouse Shh (Q15465) recombinant protein expressed in Escherichia coli.