Ver mas grande
Ccl19 (Mouse) Recombinant Protein
AB-P4614
Producto nuevo
Ccl19 (Mouse) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | Ccl19 |
| Gene Alias | CKb11|ELC|MIP3B|Scya19|exodus-3 |
| Gene Description | chemokine (C-C motif) ligand 19 |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | No additive |
| Gene ID | 24047 |
Más información
Mouse Ccl19 (Q548P0) recombinant protein expressed in Escherichia coli.