Ver mas grande
Human CXCL3 (P19876) recombinant protein expressed in iEscherichia coli/i.
AB-P4570
Producto nuevo
CXCL3 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | CXCL3 |
| Gene Alias | CINC-2b|GRO3|GROg|MIP-2b|MIP2B|SCYB3 |
| Gene Description | chemokine (C-X-C motif) ligand 3 |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized with 10 mM Na<sub>2</sub>PO<sub>4</sub>, pH 7.5. |
| Gene ID | 2921 |
Más información
Human CXCL3 (P19876) recombinant protein expressed in Escherichia coli.