Ver mas grande
Mouse S100a6 (NP_035443, 1 a.a. - 89 a.a.) full-length recombinant protein with His tag expressed in iEscherichia coli/i.
AB-P4347
Producto nuevo
S100a6 (Mouse) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | S100a6 |
| Gene Alias | 2A9|5B10|CALCYCLIN|Cacy|PRA |
| Gene Description | S100 calcium binding protein A6 (calcyclin) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.5 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Quality control testing | 15% SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | In 20 mM Tris-HCl buffer, 100 mM NaCl, pH 8.0 (1 mM DTT, 30% glycerol). |
| Gene ID | 20200 |
Más información
Mouse S100a6 (NP_035443, 1 a.a. - 89 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.