Ver mas grande
Adipoq (Mouse) Recombinant Protein
AB-P4326
Producto nuevo
Adipoq (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | Adipoq |
| Gene Alias | 30kDa|APN|Acdc|Acrp30|GBP28|adipo|apM1 |
| Gene Description | adiponectin, C1Q and collagen domain containing |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Quality control testing | 15% SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | In 20 mM Tris-HCl buffer, 50 mM NaCl, pH 7.5 (5 mM DTT, 10% glycerol). |
| Gene ID | 11450 |
Más información
Mouse Adipoq (NP_033735, 111 a.a. - 247 a.a.) partial recombinant protein expressed in Escherichia coli.