Ver mas grande
Human MRCL3 (NP_006462, 1 a.a. - 171 a.a. ) full-length recombinant protein with His tag expressed in iEscherichia coli/i.
AB-P3932
Producto nuevo
MRCL3 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | MYL12A |
| Gene Alias | MLCB|MRCL3|MRLC3|MYL2B |
| Gene Description | myosin light chain 12A |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.25 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSHMSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | In 20 mM Tris-HCl buffer, pH 8.0 (20% glycerol, 1 mM DTT). |
| Gene ID | 10627 |
Más información
Human MRCL3 (NP_006462, 1 a.a. - 171 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli.