Ver mas grande
VEGFA (Human) Recombinant Protein
AB-P3673
Producto nuevo
VEGFA (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | VEGFA |
| Gene Alias | MGC70609|VEGF|VEGF-A|VPF |
| Gene Description | vascular endothelial growth factor A |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 20 mM PB, pH 7.0 |
| Gene ID | 7422 |
Más información
Human VEGFA (P15692, 27 a.a. - 191 a.a.) partial recombinant protein expressed in Escherichia coli.