Ver mas grande
IL6 (Human) Recombinant Protein
AB-P3640
Producto nuevo
IL6 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | IL6 |
| Gene Alias | BSF2|HGF|HSF|IFNB2|IL-6 |
| Gene Description | interleukin 6 (interferon, beta 2) |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from, PBS, pH 7.0 |
| Gene ID | 3569 |
Más información
Human IL6 (P05231, 30 a.a. - 212 a.a.) partial recombinant protein expressed in Escherichia coli.