Ver mas grande
Human CCL15 (Q16663, 22 a.a. - 113 a.a.) partial recombinant protein expressed in iEscherichia coli/i.
AB-P3619
Producto nuevo
CCL15 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | CCL15 |
| Gene Alias | HCC-2|HMRP-2B|LKN1|Lkn-1|MIP-1d|MIP-5|NCC-3|NCC3|SCYA15|SCYL3|SY15 |
| Gene Description | chemokine (C-C motif) ligand 15 |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 20 mM PB, 100 mM NaCl, pH 7.5 |
| Gene ID | 6359 |
Más información
Human CCL15 (Q16663, 22 a.a. - 113 a.a.) partial recombinant protein expressed in Escherichia coli.