Ver mas grande
Human CSF2 (P04141, 1 a.a. - 144 a.a.) full-length recombinant protein. expressed in iEscherichia coli/i.
AB-P3614
Producto nuevo
CSF2 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | CSF2 |
| Gene Alias | GMCSF|MGC131935|MGC138897 |
| Gene Description | colony stimulating factor 2 (granulocyte-macrophage) |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from PBS, pH 7.0 |
| Gene ID | 1437 |
Más información
Human CSF2 (P04141, 1 a.a. - 144 a.a.) full-length recombinant protein. expressed in Escherichia coli.