FGF9 (Human) Recombinant Protein Ver mas grande

FGF9 (Human) Recombinant Protein

AB-P3608

Producto nuevo

FGF9 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 20 ug
Gene Name FGF9
Gene Alias GAF|HBFG-9|MGC119914|MGC119915
Gene Description fibroblast growth factor 9 (glia-activating factor)
Storage Conditions Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS
Gene ID 2254

Más información

Human FGF9 (P31371, 1 a.a. - 208 a.a.) full-length recombinant protein. expressed in Escherichia coli.

Consulta sobre un producto

FGF9 (Human) Recombinant Protein

FGF9 (Human) Recombinant Protein