Ver mas grande
Human TNFSF9 (NP_003802, 71 a.a. - 254 a.a.) partial recombinant protein with His tag expressed in iEscherichia coli/i.
AB-P3533
Producto nuevo
TNFSF9 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | TNFSF9 |
| Gene Alias | 4-1BB-L|CD137L |
| Gene Description | tumor necrosis factor (ligand) superfamily, member 9 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 20 mM Tris-HCl buffer, 100 mM NaCl, pH 8.0 (20% glycerol). |
| Gene ID | 8744 |
Más información
Human TNFSF9 (NP_003802, 71 a.a. - 254 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.