LTA (Human) Recombinant Protein Ver mas grande

LTA (Human) Recombinant Protein

AB-P3506

Producto nuevo

LTA (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 50 ug
Gene Name LTA
Gene Alias LT|TNFB|TNFSF1
Gene Description lymphotoxin alpha (TNF superfamily, member 1)
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (1 mM DTT, 30% glycerol).
Gene ID 4049

Más información

Human LTA (NP_001153212, 35 a.a. - 205 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.

Consulta sobre un producto

LTA (Human) Recombinant Protein

LTA (Human) Recombinant Protein