Ver mas grande
Human AKR7A2 (NP_003680, 1 a.a. - 359 a.a.) full-length recombinant protein with His tag expressed in iEscherichia coli/i.
AB-P3498
Producto nuevo
AKR7A2 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | AKR7A2 |
| Gene Alias | AFAR|AFAR1|AFB1-AR1|AKR7 |
| Gene Description | aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.5 mg/mL |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELEMLSAASRVVSRAAVHCALRSPPPEARALAMSRPPPPRVASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLR |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 20 mM Tris-HCl buffer, pH 8.0 (1 mM DTT, 20% glycerol). |
| Gene ID | 8574 |
Más información
Human AKR7A2 (NP_003680, 1 a.a. - 359 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.