NDRG1 (Human) Recombinant Protein Ver mas grande

Human NDRG1 (NP_006087, 1 a.a. - 394 a.a.) full-length recombinant protein with His tag expressed in iEscherichia coli/i.

AB-P3493

Producto nuevo

NDRG1 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 100 ug
Gene Name NDRG1
Gene Alias CAP43|CMT4D|DRG1|GC4|HMSNL|NDR1|NMSL|PROXY1|RIT42|RTP|TARG1|TDD5
Gene Description N-myc downstream regulated 1
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPA
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol, 0.1 mM PMSF).
Gene ID 10397

Más información

Human NDRG1 (NP_006087, 1 a.a. - 394 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.

Consulta sobre un producto

Human NDRG1 (NP_006087, 1 a.a. - 394 a.a.) full-length recombinant protein with His tag expressed in iEscherichia coli/i.

Human NDRG1 (NP_006087, 1 a.a. - 394 a.a.) full-length recombinant protein with His tag expressed in iEscherichia coli/i.