Ver mas grande
Human MAP1LC3B2 (NP_001078950, 1 a.a. - 120 a.a.) full-length recombinant protein with His tag expressed in iEscherichia coli/i.
AB-P3434
Producto nuevo
MAP1LC3B2 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | MAP1LC3B2 |
| Gene Alias | - |
| Gene Description | microtubule-associated protein 1 light chain 3 beta 2 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVCASQETFG |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (1 mM DTT, 10% glycerol). |
| Gene ID | 643246 |
Más información
Human MAP1LC3B2 (NP_001078950, 1 a.a. - 120 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.