Ver mas grande
Human GDF5 (NP_000548, 382 a.a. - 501 a.a.) partial recombinant protein with His tag at N-terminal expressed in iEscherichia col
AB-P3399
Producto nuevo
GDF5 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | GDF5 |
| Gene Alias | BMP14|CDMP1|LAP4|SYNS2 |
| Gene Description | growth differentiation factor 5 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.5 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 10 mM Sodium Citrate buffer, pH 3.5 (10% glycerol). |
| Gene ID | 8200 |
Más información
Human GDF5 (NP_000548, 382 a.a. - 501 a.a.) partial recombinant protein with His tag at N-terminal expressed in Escherichia coli.