Ver mas grande
CEBPA (Human) Recombinant Protein
AB-P3389
Producto nuevo
CEBPA (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | CEBPA |
| Gene Alias | C/EBP-alpha|CEBP |
| Gene Description | CCAAT/enhancer binding protein (C/EBP), alpha |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 7.5 (5 mM beta-Mercaptoethanol). |
| Gene ID | 1050 |
Más información
Human CEBPA (NP_004355, 270 a.a. - 358 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.