> >>>Human SLC6A19 full-length ORF ( NP_001003841.1, 1 a.a. - 634 a.a.) recombinant protein with GST-tag at N-terminal.
SLC6A19 (Human) Recombinant Protein (P01) Ver mas grande

Human SLC6A19 full-length ORF ( NP_001003841.1, 1 a.a. - 634 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00340024-P01

Producto nuevo

SLC6A19 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 2 ug
Gene Name SLC6A19
Gene Alias B0AT1|FLJ20680|FLJ34635|HND
Gene Description solute carrier family 6 (neutral amino acid transporter), member 19
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MVRLVLPNPGLDARIPSLAELETIEQEEASSRPKWDNKAQYMLTCLGFCVGLGNVWRFPYLCQSHGGGAFMIPFLILLVLEGIPLLYLEFAIGQRLRRGSLGVWSSIHPALKGLGLASMLTSFMVGLYYNTIISWIMWYLFNSFQEPLPWSDCPLNENQTGYVDECARSSPVDYFWYRETLNISTSISDSGSIQWWMLLCLACAWSVLYMCTIRGIETTGKAVYITSTLPYVVLTIFLIRGLTLKGATNGIVFLF
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 340024

Más información

Human SLC6A19 full-length ORF ( NP_001003841.1, 1 a.a. - 634 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human SLC6A19 full-length ORF ( NP_001003841.1, 1 a.a. - 634 a.a.) recombinant protein with GST-tag at N-terminal.

Human SLC6A19 full-length ORF ( NP_001003841.1, 1 a.a. - 634 a.a.) recombinant protein with GST-tag at N-terminal.