> >>>Human C6orf151 full-length ORF ( NP_689764.3, 1 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal.
C6orf151 (Human) Recombinant Protein (P01) Ver mas grande

Human C6orf151 full-length ORF ( NP_689764.3, 1 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00154007-P01

Producto nuevo

C6orf151 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name SNRNP48
Gene Alias C6orf151|FLJ32234|MGC138904|MGC138905|dJ336K20B.1|dJ512B11.2
Gene Description small nuclear ribonucleoprotein 48kDa (U11/U12)
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MEGEPPPVEERRRLQEELNEFVESGCRTLEEVTASLGWDLDSLDPGEEEAAEDEVVICPYDSNHHMPKSSLAKHMASCRLRKMGYTKEEEDEMYNPEFFYENVKIPSITLNKDSQFQIIKQARTAVGKDSDCYNQRIYSSLPVEVPLNHKRFVCDLTQADRLALYDFVVEETKKKRSDSQIIENDSDLFVDLAAKINQDNSRKSPKSYLEILAEVRDYKRRRQSYRAKNVHITKKSYTEVIRDVINVHMEELSNH
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 154007

Más información

Human C6orf151 full-length ORF ( NP_689764.3, 1 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human C6orf151 full-length ORF ( NP_689764.3, 1 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal.

Human C6orf151 full-length ORF ( NP_689764.3, 1 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal.