SMAP1L (Human) Recombinant Protein (P01) Ver mas grande

Human SMAP1L full-length ORF ( NP_073570.1, 1 a.a. - 429 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00064744-P01

Producto nuevo

SMAP1L (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name SMAP2
Gene Alias RP1-228H13.3|SMAP1L
Gene Description small ArfGAP2
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MTGKSVKDVDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINAFRKEKDDKWKRGSEPVPEKKLEPVVFEKVKMPQKKEDPQLPRKSSPKSTAPVMDLLGLDAPVACSIANSKTSNTLEKDLDLLASVPSPSSSGSRKVVGSMPTAGSAGSVPENLNLFPEPGSKS
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 64744

Más información

Human SMAP1L full-length ORF ( NP_073570.1, 1 a.a. - 429 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human SMAP1L full-length ORF ( NP_073570.1, 1 a.a. - 429 a.a.) recombinant protein with GST-tag at N-terminal.

Human SMAP1L full-length ORF ( NP_073570.1, 1 a.a. - 429 a.a.) recombinant protein with GST-tag at N-terminal.