Ver mas grande
IKZF4 (Human) Recombinant Protein (P01)
AB-H00064375-P01
Producto nuevo
IKZF4 (Human) Recombinant Protein (P01)
No hay Biopuntos para este producto
Hoja técnica
| Size | 2 ug |
| Gene Name | IKZF4 |
| Gene Alias | EOS|KIAA1782|ZNFN1A4 |
| Gene Description | IKAROS family zinc finger 4 (Eos) |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Application Key | ELISA,WB-Re,AP,Array |
| Immunogen Prot. Seq | MDSRYLQLQLYLPSCSLLQGSGDSSLEKEFLGAPVGPSVSTPNSQHSSPSRSLSANSIKVEMYSDEESSRLLGPDERLLEKDDSVIVEDSLSEPLGYCDGSGPEPHSPGGIRLPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFKCPFCNYACRRRDALTGHLRTHSVSSPTVGKPYKCNYCGRSYKQQSTLEEHKERCHNYLQSLSTEAQALAGQPGDEIRDLE |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 64375 |
Más información
Human IKZF4 full-length ORF ( ENSP00000262032, 1 a.a. - 544 a.a.) recombinant protein with GST-tag at N-terminal.