Ver mas grande
RXFP1 (Human) Recombinant Protein
AB-H00059350-G01
Producto nuevo
RXFP1 (Human) Recombinant Protein
No hay Biopuntos para este producto
Hoja técnica
| Size | 10 ug |
| Gene Name | RXFP1 |
| Gene Alias | LGR7|LGR7.1|LGR7.10|LGR7.2|MGC138347|MGC142177|RXFPR1 |
| Gene Description | relaxin/insulin-like family peptide receptor 1 |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Application Key | AP |
| Immunogen Prot. Seq | MTSGSVFFYILIFGKYFSHGGGQDVKCSLGYFPCGNITKCLPQLLHCNGVDDCGNQADEDNCGDNNGWSLQFDKYFASYYKMTSQYPFEAETPECLVGSVPVQCLCQGLELDCDETNLRAVPSVSSNVTAMSLQWNLIRKLPPDCFKNYHDLQKLYLQNNKITSISIYAFRGLNSLTKLYLSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPPTFYGLNSLILLVLMNNVLTRLPDKPLCQHMPRLHWLDLE |
| Form | Liquid |
| Recomended Dilution | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Antigen species Target species | Human |
| Storage Buffer | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene ID | 59350 |
Más información
Human RXFP1 full-length ORF (ADR83250.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
This product is belong to Proteoliposome (PL).