> >>>Human KLK12 full-length ORF ( NP_665902.1, 1 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal.
KLK12 (Human) Recombinant Protein (P01) Ver mas grande

Human KLK12 full-length ORF ( NP_665902.1, 1 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00043849-P01

Producto nuevo

KLK12 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name KLK12
Gene Alias DKFZp686H1078|KLK-L5|KLKL5|MGC42603
Gene Description kallikrein-related peptidase 12
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MGLSIFLLLCVLGLSQAATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGRPIPGSAPVPQPLHRLPCHLPWCVSRENHEQHGVCRRRPGAGCLPG
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 43849

Más información

Human KLK12 full-length ORF ( NP_665902.1, 1 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human KLK12 full-length ORF ( NP_665902.1, 1 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal.

Human KLK12 full-length ORF ( NP_665902.1, 1 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal.