> >>>Human WDR21A full-length ORF ( NP_851937.1, 1 a.a. - 395 a.a.) recombinant protein with GST-tag at N-terminal.
WDR21A (Human) Recombinant Protein (P01) Ver mas grande

Human WDR21A full-length ORF ( NP_851937.1, 1 a.a. - 395 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00026094-P01

Producto nuevo

WDR21A (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name WDR21A
Gene Alias DKFZp434K114|MGC20547|MGC46524|WDR21
Gene Description WD repeat domain 21A
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MESKRLRLLQEEDRRKKIARMGFNASSMLRKSQLGFLNVTNYCHLAHELRLSCMERKKVQIRSMDPSALASDRFNLILADTNSDRLFTVNDVKVGGSKYGIINLQSLKTPTLKVFMHENLYFTNRKVNSVCWASLNHLDSHILLCLMGLAETPGCATLLPASLFVNSHPGIDRPGMLCSFRIPGAWSCAWSLNIQANNCFSTGLSRRVLLTNVVTGHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRC
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 26094

Más información

Human WDR21A full-length ORF ( NP_851937.1, 1 a.a. - 395 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human WDR21A full-length ORF ( NP_851937.1, 1 a.a. - 395 a.a.) recombinant protein with GST-tag at N-terminal.

Human WDR21A full-length ORF ( NP_851937.1, 1 a.a. - 395 a.a.) recombinant protein with GST-tag at N-terminal.