> >>>Human SYNCRIP full-length ORF ( AAH40844.1, 1 a.a. - 410 a.a.) recombinant protein with GST-tag at N-terminal.
SYNCRIP (Human) Recombinant Protein (P02) Ver mas grande

Human SYNCRIP full-length ORF ( AAH40844.1, 1 a.a. - 410 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00010492-P02

Producto nuevo

SYNCRIP (Human) Recombinant Protein (P02)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name SYNCRIP
Gene Alias GRY-RBP|HNRPQ1|NSAP1|RP1-3J17.2|dJ3J17.2|hnRNP-Q|pp68
Gene Description synaptotagmin binding, cytoplasmic RNA interacting protein
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MEDHLQIPFIQIFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLTGLNRGYAFVTFCTKEAAQEAVKLYNNHEIRSGKHIGVCISVANNRLFVGSIPKSKTKEQILEEFSKVTEGLTDVILYHQPDDKKKNRGSCFLEYEDHKTAAQARRRLMSGKVKVWGNVGTVEWADPIEDPDPEVMAKVKVLFVRNLANTVTEEILEKAFSQFGKLERVKKLKDYAFIHFDERDGAVKAMEEMNGKDLEGENIEIVFAK
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 10492

Más información

Human SYNCRIP full-length ORF ( AAH40844.1, 1 a.a. - 410 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human SYNCRIP full-length ORF ( AAH40844.1, 1 a.a. - 410 a.a.) recombinant protein with GST-tag at N-terminal.

Human SYNCRIP full-length ORF ( AAH40844.1, 1 a.a. - 410 a.a.) recombinant protein with GST-tag at N-terminal.