> >>>Human CALCRL full-length ORF ( NP_005786.1, 1 a.a. - 461 a.a.) recombinant protein with GST-tag at N-terminal.
CALCRL (Human) Recombinant Protein (P02) Ver mas grande

Human CALCRL full-length ORF ( NP_005786.1, 1 a.a. - 461 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00010203-P02

Producto nuevo

CALCRL (Human) Recombinant Protein (P02)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name CALCRL
Gene Alias CGRPR|CRLR
Gene Description calcitonin receptor-like
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MEKKCTLYFLVLLPFFMILVTAELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNLFFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWY
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 10203

Más información

Human CALCRL full-length ORF ( NP_005786.1, 1 a.a. - 461 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human CALCRL full-length ORF ( NP_005786.1, 1 a.a. - 461 a.a.) recombinant protein with GST-tag at N-terminal.

Human CALCRL full-length ORF ( NP_005786.1, 1 a.a. - 461 a.a.) recombinant protein with GST-tag at N-terminal.