SLC7A7 (Human) Recombinant Protein (P02) Ver mas grande

Human SLC7A7 full-length ORF ( AAH03062.1, 1 a.a. - 511 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00009056-P02

Producto nuevo

SLC7A7 (Human) Recombinant Protein (P02)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name SLC7A7
Gene Alias LAT3|LPI|MOP-2|Y+LAT1|y+LAT-1
Gene Description solute carrier family 7 (cationic amino acid transporter, y+ system), member 7
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MVDSTEYEVASQPEVETSPLGDGASPGPEQVKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYSGWDTLNYVTEEIKNP
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 9056

Más información

Human SLC7A7 full-length ORF ( AAH03062.1, 1 a.a. - 511 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human SLC7A7 full-length ORF ( AAH03062.1, 1 a.a. - 511 a.a.) recombinant protein with GST-tag at N-terminal.

Human SLC7A7 full-length ORF ( AAH03062.1, 1 a.a. - 511 a.a.) recombinant protein with GST-tag at N-terminal.