> >>>Human TGFB1 partial ORF ( NP_000651, 281 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal.
TGFB1 (Human) Recombinant Protein (Q01) Ver mas grande

Human TGFB1 partial ORF ( NP_000651, 281 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00007040-Q01

Producto nuevo

TGFB1 (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name TGFB1
Gene Alias CED|DPD1|TGFB|TGFbeta
Gene Description transforming growth factor, beta 1
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 7040

Más información

Human TGFB1 partial ORF ( NP_000651, 281 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human TGFB1 partial ORF ( NP_000651, 281 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal.

Human TGFB1 partial ORF ( NP_000651, 281 a.a. - 390 a.a.) recombinant protein with GST-tag at N-terminal.