AB-H00006545-P01
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 10 ug |
Gene Name | SLC7A4 |
Gene Alias | CAT-4|CAT4|HCAT3|MGC129976|MGC129977|VH |
Gene Description | solute carrier family 7 (cationic amino acid transporter, y+ system), member 4 |
Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
Application Key | ELISA,WB-Re,AP,Array |
Immunogen Prot. Seq | MARGLPTIASLARLCQKLNRLKPLEDSIMETSLRRCLSTLDLTLLGVGGMVGSGLYVLTGAVAKEVAGPAVLLSFGVAAVASLLAALCYAEFGARVPRTGSAYLFTYVSMGELWAFLIGWNVLLEYIIGGAAVARAWSGYLDSMFSHSIRNFTETHVGSWQVPLLGHYPDFLAAGIILLASAFVSCGARVSSWLNHTFSAISLLVILFIVILGFILAQPHNWSADEGGFAPFGFSGVMAGTASCFYAFVGFDVIA |
Antigen species Target species | Human |
Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID | 6545 |