> >>>Human SELP full-length ORF ( AAH68533.1, 1 a.a. - 829 a.a.) recombinant protein with GST-tag at N-terminal.
SELP (Human) Recombinant Protein (P01) Ver mas grande

Human SELP full-length ORF ( AAH68533.1, 1 a.a. - 829 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00006403-P01

Producto nuevo

SELP (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name SELP
Gene Alias CD62|CD62P|FLJ45155|GMP140|GRMP|LECAM3|PADGEM|PSEL
Gene Description selectin P (granule membrane protein 140kDa, antigen CD62)
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MANCQIAILYQRFQRVVFGISQLLCFSALISELTNQKEVAAWTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPSKLECLASGIWTNKPP
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 6403

Más información

Human SELP full-length ORF ( AAH68533.1, 1 a.a. - 829 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human SELP full-length ORF ( AAH68533.1, 1 a.a. - 829 a.a.) recombinant protein with GST-tag at N-terminal.

Human SELP full-length ORF ( AAH68533.1, 1 a.a. - 829 a.a.) recombinant protein with GST-tag at N-terminal.