> >>>Human CCL20 full-length ORF ( AAH20698, 27 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.
CCL20 (Human) Recombinant Protein (P01) Ver mas grande

Human CCL20 full-length ORF ( AAH20698, 27 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00006364-P01

Producto nuevo

CCL20 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name CCL20
Gene Alias CKb4|LARC|MIP-3a|MIP3A|SCYA20|ST38
Gene Description chemokine (C-C motif) ligand 20
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq SNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 6364

Más información

Human CCL20 full-length ORF ( AAH20698, 27 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human CCL20 full-length ORF ( AAH20698, 27 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.

Human CCL20 full-length ORF ( AAH20698, 27 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.