> >>>Human BRD2 full-length ORF ( NP_005095.1, 1 a.a. - 801 a.a.) recombinant protein with GST-tag at N-terminal.
BRD2 (Human) Recombinant Protein (P01) Ver mas grande

Human BRD2 full-length ORF ( NP_005095.1, 1 a.a. - 801 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00006046-P01

Producto nuevo

BRD2 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name BRD2
Gene Alias D6S113E|DKFZp686N0336|FLJ31942|FSH|FSRG1|KIAA9001|NAT|RING3|RNF3
Gene Description bromodomain containing 2
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MLQNVTPHNKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLTPANPPPPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLH
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 6046

Más información

Human BRD2 full-length ORF ( NP_005095.1, 1 a.a. - 801 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human BRD2 full-length ORF ( NP_005095.1, 1 a.a. - 801 a.a.) recombinant protein with GST-tag at N-terminal.

Human BRD2 full-length ORF ( NP_005095.1, 1 a.a. - 801 a.a.) recombinant protein with GST-tag at N-terminal.