> >>>Human EPCAM full-length ORF ( AAH14785.1, 1 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal.
EPCAM (Human) Recombinant Protein (P01) Ver mas grande

Human EPCAM full-length ORF ( AAH14785.1, 1 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00004072-P01

Producto nuevo

EPCAM (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name EPCAM
Gene Alias 17-1A|323/A3|CD326|CO-17A|CO17-1A|EGP|EGP-2|EGP34|EGP40|ESA|Ep-CAM|GA733-2|HEA125|KS1/4|KSA|M4S1|MH99|MIC18|MK-1|MOC31|TACST-1|TACSTD1|TROP1|hEGP-2
Gene Description epithelial cell adhesion molecule
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEK
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 4072

Más información

Human EPCAM full-length ORF ( AAH14785.1, 1 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human EPCAM full-length ORF ( AAH14785.1, 1 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal.

Human EPCAM full-length ORF ( AAH14785.1, 1 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal.