KIR2DS1 (Human) Recombinant Protein Ver mas grande

Human KIR2DS1 full-length ORF (AAI66637.1) recombinant protein without tag.brThis product is belong to Proteoliposome (PL).

AB-H00003806-G01

Producto nuevo

KIR2DS1 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 ug
Gene Name KIR2DS1
Gene Alias CD158H|CD158a|p50.1
Gene Description killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MSLTVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMKQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLHVLIGTSVVKI
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3806

Más información

Human KIR2DS1 full-length ORF (AAI66637.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).

Consulta sobre un producto

Human KIR2DS1 full-length ORF (AAI66637.1) recombinant protein without tag.brThis product is belong to Proteoliposome (PL).

Human KIR2DS1 full-length ORF (AAI66637.1) recombinant protein without tag.brThis product is belong to Proteoliposome (PL).