HBG1 (Human) Recombinant Protein (P02) Ver mas grande

Human HBG1 full-length ORF ( AAH10914, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00003047-P02

Producto nuevo

HBG1 (Human) Recombinant Protein (P02)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name HBG1
Gene Alias HBGA|HBGR|HSGGL1|PRO2979
Gene Description hemoglobin, gamma A
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 3047

Más información

Human HBG1 full-length ORF ( AAH10914, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human HBG1 full-length ORF ( AAH10914, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.

Human HBG1 full-length ORF ( AAH10914, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.