> >>>Human FOLR3 full-length ORF ( AAI48786.1, 1 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal.
FOLR3 (Human) Recombinant Protein (P01) Ver mas grande

Human FOLR3 full-length ORF ( AAI48786.1, 1 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00002352-P01

Producto nuevo

FOLR3 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name FOLR3
Gene Alias FR-G|FR-gamma|gamma-hFR
Gene Description folate receptor 3 (gamma)
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 2352

Más información

Human FOLR3 full-length ORF ( AAI48786.1, 1 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human FOLR3 full-length ORF ( AAI48786.1, 1 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal.

Human FOLR3 full-length ORF ( AAI48786.1, 1 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal.