> >>>Human FGF2 partial ORF ( NP_001997, 189 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal.
FGF2 (Human) Recombinant Protein (Q01) Ver mas grande

Human FGF2 partial ORF ( NP_001997, 189 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00002247-Q01

Producto nuevo

FGF2 (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name FGF2
Gene Alias BFGF|FGFB|HBGF-2
Gene Description fibroblast growth factor 2 (basic)
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq SDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 2247

Más información

Human FGF2 partial ORF ( NP_001997, 189 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human FGF2 partial ORF ( NP_001997, 189 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal.

Human FGF2 partial ORF ( NP_001997, 189 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal.