ETV2 (Human) Recombinant Protein (P01) Ver mas grande

Human ETV2 full-length ORF (AAI60032.1, 1 a.a. - 342 a.a.) recombinant protein with GST tag at N-terminal.

AB-H00002116-P01

Producto nuevo

ETV2 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name ETV2
Gene Alias ER71|ETSRP71|MGC129834|MGC129835
Gene Description ets variant 2
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MDLWNWDEASPQEVPPGNKLAGLEGAKLGFCFPDLALQGDTPTATAETCWKGTSSSLASFPQLDWGSALLHPEVPWGAEPDSQALPWSGDWTDMACTAWDSWSGASQTLGPAPLGPGPIPAAGSEGAAGQNCVPVAGEATSWSRAQAAGSNTSWDCSVGPDGDTYWGSGLGGEPRTDCTISWGGPAGPDCTTSWNPGLHAGGTTSLKRYQSSALTVCSEPSPQSDRASLARCPKTNHRGPIQLWQFLLELLHDGA
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 2116

Más información

Human ETV2 full-length ORF (AAI60032.1, 1 a.a. - 342 a.a.) recombinant protein with GST tag at N-terminal.

Consulta sobre un producto

Human ETV2 full-length ORF (AAI60032.1, 1 a.a. - 342 a.a.) recombinant protein with GST tag at N-terminal.

Human ETV2 full-length ORF (AAI60032.1, 1 a.a. - 342 a.a.) recombinant protein with GST tag at N-terminal.