> >>>Human DNASE1L3 partial ORF ( AAH15831, 51 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.
DNASE1L3 (Human) Recombinant Protein (Q01) Ver mas grande

Human DNASE1L3 partial ORF ( AAH15831, 51 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00001776-Q01

Producto nuevo

DNASE1L3 (Human) Recombinant Protein (Q01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 10 ug
Gene Name DNASE1L3
Gene Alias DHP2|DNAS1L3|LSD
Gene Description deoxyribonuclease I-like 3
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq RCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFV
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 1776

Más información

Human DNASE1L3 partial ORF ( AAH15831, 51 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Human DNASE1L3 partial ORF ( AAH15831, 51 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.

Human DNASE1L3 partial ORF ( AAH15831, 51 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.